Paisley Acid Wash Made in PAK Sweatshirt
⚠ This store advertises PKR 45,400 (−20%)
But since we started tracking it, we've never seen it priced above PKR 36,400. The real drop is 0% — check the price history below.
Sizes
- XXS
- XS
- S
- M
- L
- XL
- XXL
Opens pk.rastah.co · checked 1d ago
About this product
Crafted from 500 GSM 100% cotton fleece, this oversized black crewneck sweatshirt is finished with an acid wash for a worn, tonal appearance. The front features a screen-printed Rastah logo in a golden tone and a paisley motif near the hem. The back expands the composition with blue Rastah lettering, Urdu text reading “Made in Pakistan,” and a larger paisley graphic, placing local identity and origin at the centre of the design. KEY SPECIFICATIONS 500 GSM 100% cotton fleece Black acid-wash Oversized crewneck silhouette Screen-printed chest logo in a golden tone Screen-printed paisley motif at the lower front Multicolour screen-printed back artwork “Made in Pakistan” Urdu typography Ribbed neckline, cuffs and hem CARE GUIDE Machine wash cold, inside out, with similar colours Use mild detergent Do not bleach Iron inside out at low heat, avoiding direct contact with the screen-printed artwork
Details
- Brand
- Rastah
- Audience
- men
- Category
- men
- SKU
- PAISLEYACIDWASHMADEINPAKSWEATSHIRT-XXS-01
- Availability
- In stock
- First seen
- 1d ago
- Last checked
- 1d ago
- Source
- pk.rastah.co →
More from Rastah
View all →
